NBP1-55342 Rabex5 antibody

See related secondary antibodies

Search for all "Rabex5"

50 µg / €390.00

Quick Overview

Rabbit anti Human Rabex5


Product Description for Rabex5

Rabbit anti Human Rabex5.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for Rabex5

Product Category Primary Antibodies
Quantity 50 µg
Synonyms FLJ32302, RABEX5, rabex-5
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to RABGEF1(RAB guanine nucleotide exchange factor (GEF) 1) The peptide sequence was selected from the N terminal of RABGEF1. Peptide sequence MSLKSERRGIHVDQSDLLCKKGCGYYGNPAWQGFCSKCWREEYHKARQKQ.
Background RABGEF1 forms a complex with rabaptin-5 (RABPT5; MIM 603616) that is required for endocytic membrane fusion, and it serves as a specific guanine nucleotide exchange factor (GEF) for RAB5 (RAB5A; MIM 179512) (Horiuchi et al., 1997 [PubMed 9323142]).
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified

Accessory Products

  • LinkedIn