
NBP1-57430 RAD51AP1 antibody

See related secondary antibodies

Search for all "RAD51AP1"

50 µg / €390.00

Quick Overview

Rabbit anti Human RAD51AP1

Product Description for RAD51AP1

Rabbit anti Human RAD51AP1.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for RAD51AP1

Product Category Primary Antibodies
Quantity 50 µg
Synonyms PIR51
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to RAD51AP1(RAD51 associated protein 1) The peptide sequence was selected from the middle region of RAD51AP1. Peptide sequence EDDVGGVQGKRKAASKAAAQQRKILLEGSDGDSANDTEPDFAPGEDSEDD.
Background RAD51AP1 may participate in a common DNA damage response pathway associated with the activation of homologous recombination and double-strand break repair. RAD51AP1 binds to single and double stranded DNA, and is capable of aggregating DNA. RAD51AP1 also binds RNA.
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified
Gene ID 10635

Accessory Products

  • LinkedIn