discontinued

NBP1-56832 RALGDS antibody

See related secondary antibodies

Search for all "RALGDS"

50 µg / €440.00

Quick Overview

Rabbit anti Human RALGDS

Product Description for RALGDS

Rabbit anti Human RALGDS.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for RALGDS

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6KH11
Immunogen:
Synthetic peptides corresponding to RALGDS(ral guanine nucleotide dissociation stimulator) The peptide sequence was selected from the N terminal of RALGDS. Peptide sequence KRYGRCDALTASSRYGCILPYSDEDGGPQDQLKNAISSILGTWLDQYSED.
GeneID:
5900
Background The specific function of this protein remains unknown.
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Aff - Purified
Gene ID 5900

Accessory Products

  • LinkedIn