NBP1-56832 RALGDS antibody

See related secondary antibodies

Search for all "RALGDS"

50 µg / €440.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human RALGDS

Product Description for RALGDS

Rabbit anti Human RALGDS.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for RALGDS

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6KH11
Immunogen:
Synthetic peptides corresponding to RALGDS(ral guanine nucleotide dissociation stimulator) The peptide sequence was selected from the N terminal of RALGDS. Peptide sequence KRYGRCDALTASSRYGCILPYSDEDGGPQDQLKNAISSILGTWLDQYSED.
GeneID:
5900
Background The specific function of this protein remains unknown.
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Aff - Purified
Gene ID 5900

Accessory Products

  • LinkedIn