discontinued

H00010527-M07 RanBP7 / Importin-7 antibody

See related secondary antibodies

Search for all "RanBP7 / Importin-7"

Quick Overview

Mouse anti Human RanBP7 / Importin-7 4G6

Product Description for RanBP7 / Importin-7

Mouse anti Human RanBP7 / Importin-7 4G6.
Presentation: Purified
Product is tested for Enzyme Immunoassay, Western blot / Immunoblot.

Properties for RanBP7 / Importin-7

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms IMP7, IPO7, Ran-binding protein 7
Presentation Purified
Reactivity Hu
Applications E, WB
Clonality Monoclonal
Clone 4G6
Host Mouse
Isotype IgG2b
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
O95373
Immunogen:
IPO7 (NP_006382, 950 a.a. ~ 1039 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
AA Sequence:
DDEDNPVDEYQIFKAIFQTIQNRNPVWYQALTHGLNEEQRKQLQDIATLADQRRAAHESKMIEKHGGYKFSAPVVP SSFNFGGPAPGMN*
GeneID:
10527
Remarks:
Gene Accession: NM_006391
Isotype control AM03110PU-N, SM12P
Add. information Mouse monoclonal antibody raised against a partial recombinant IPO7.

Antibody Reactive Against Recombinant Protein.
Application ELISA,WB-Ce,WB-Re
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 10527

Accessory Products

Proteins and/or Positive Controls

Proteins for RanBP7 / Importin-7 (2 products)

Catalog No. Species Pres. Purity   Source  

RanBP7 / Importin-7

RanBP7 / Importin-7 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

RanBP7 / Importin-7

RanBP7 / Importin-7 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.
  • LinkedIn