discontinued

H00051195-M04 RAPGEFL1 antibody

See related secondary antibodies

Search for all "RAPGEFL1"

Quick Overview

Mouse anti Human RAPGEFL1 4G2

H00051195-M04

More Views

  • H00051195-M04

Product Description for RAPGEFL1

Mouse anti Human RAPGEFL1 4G2.
Presentation: Purified
Product is tested for Enzyme Immunoassay, Western blot / Immunoblot.

Properties for RAPGEFL1

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms Link GEFII, Link guanine nucleotide exchange factor II, Rap guanine nucleotide exchange factor-like 1
Presentation Purified
Reactivity Hu
Applications E, WB
Clonality Monoclonal
Clone 4G2
Host Mouse
Isotype IgG2a
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9UHV5
Immunogen:
RAPGEFL1 (NP_057423, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
AA Sequence:
MEGPEGLGRKQACLAMLLHFLDTYQGLLQEEEGAGHIIKDLYLLIMKDESLYQGLREDTLRLHQLVETVELKIPEE NQPPSKQVKPLFRHFRRIDSCLQ*
GeneID:
51195
Remarks:
Gene Accession: NM_016339
Isotype control AM03096PU-N
Add. information Mouse monoclonal antibody raised against a partial recombinant RAPGEFL1.

Antibody Reactive Against Recombinant Protein.
Application ELISA,S-ELISA,WB-Ce,WB-Re
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 51195

Accessory Products

Proteins and/or Positive Controls

Proteins for RAPGEFL1 (2 products)

Catalog No. Species Pres. Purity   Source  

RAPGEFL1

RAPGEFL1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

RAPGEFL1

RAPGEFL1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for RAPGEFL1 (1 products)

Catalog No. Species Pres. Purity   Source  

RAPGEFL1 overexpression lysate

RAPGEFL1 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn