TA331916 RAPGEFL1 antibody

Rabbit Polyclonal Anti-RAPGEFL1 Antibody

See related secondary antibodies

Search for all "RAPGEFL1"

50 µg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish RAPGEFL1

Product Description for RAPGEFL1

Rabbit anti Bovine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish RAPGEFL1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for RAPGEFL1

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms Link GEFII, Link guanine nucleotide exchange factor II, Rap guanine nucleotide exchange factor-like 1
Presentation Purified
Reactivity Bov, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9UHV5
Immunogen:
The immunogen for Anti-RAPGEFL1 Antibody is: synthetic peptide directed towards the C-terminal region of Human RAPGEFL1. Synthetic peptide located within the following region: KFKNLFRKFENLTDPCRNHKSYREVISKMKPPVIPFVPLILKDLTFLHEG.
GeneID:
51195
Application WB
Background RAPGEFL1 is a probable guanine nucleotide exchange factor (GEF).
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for RAPGEFL1 (2 products)

Catalog No. Species Pres. Purity   Source  

RAPGEFL1

RAPGEFL1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

RAPGEFL1

RAPGEFL1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for RAPGEFL1 (1 products)

Catalog No. Species Pres. Purity   Source  

RAPGEFL1 overexpression lysate

RAPGEFL1 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn