discontinued

NBP1-90859 RAPH1 antibody

See related secondary antibodies

Search for all "RAPH1"

0.1 ml / €500.00

Quick Overview

Rabbit anti Human RAPH1

Product Description for RAPH1

Rabbit anti Human RAPH1.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Properties for RAPH1

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P
Clonality Polyclonal
Host Rabbit
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q70E73
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: NPQPQQWSKMSVKKAPPPTRPKRNDSTRLTQAEISEQPTMATVVPQVPTSPKSSLSVQPGFLADLNRTLQRKSITRHGSLSSRMSRAEPTATMDDMALPPPPPELLSDQQKAGYGGSHISGYATLRRGPPPAPPKRDQNTKLSR
GeneID:
65059
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Clear, colorless solution in phosphate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 65059

Accessory Products

Proteins and/or Positive Controls

Proteins for RAPH1 (1 products)

Catalog No. Species Pres. Purity   Source  

Ras association (RalGDS/AF-6) and pleckstrin homology domains 1 (RAPH1), transcript variant 3 (transcript variant 3)

Ras association (RalGDS/AF-6) and pleckstrin homology domains 1 (RAPH1), transcript variant 3 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

Positive controls for RAPH1 (1 products)

Catalog No. Species Pres. Purity   Source  

RAPH1 overexpression lysate

RAPH1 overexpression lysate
0.1 mg / €480.00
  OriGene Technologies, Inc.
  • LinkedIn