discontinued

H00005918-B01 RARRES1 antibody

See related secondary antibodies

Search for all "RARRES1"

Quick Overview

Mouse anti Human RARRES1

Product Description for RARRES1

Mouse anti Human RARRES1.
Presentation: Serum
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for RARRES1

Product Category Primary Antibodies
Target Category
Quantity 50 µl
Synonyms RAR-responsive protein TIG1, Retinoic acid receptor responder protein 1, TIG1, Tazarotene-induced gene 1 protein
Presentation Serum
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
P49788
Immunogen:
RARRES1 (NP_996846, 1 a.a. ~ 294 a.a) full-length human protein.
AA Sequence:
MQPRRQRLPAPWSGPRGPRPTAPLLALLLLLAPVAAPAGSGDPDDPGQPQDAGVPRRLLQQAARAALHFFNFRSGS PSALRVLAEVQEGRAWINPKEGCKVHVVFSTERYNPESLLQEGEGRLGKCSARVFFKNQKPRPTINVTCTRLIEKK KRQQEDYLLYKQMKQLKNPLEIVSIPDNHGHIDPSLRLIWDLAFLGSSYVMWEMTTQVSHYYLAQLTSVRQWKTND DTIDFDYTVLLHELSTQEIIPCRIHLVWYPGKPLKVKYHCQELQTPEEASGTEEGSAVVPTELSNF
GeneID:
5918
Remarks:
Gene Accession: NM_206963
Add. information Mouse polyclonal antibody raised against a full-length human RARRES1 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Tr
Storage No additive
Format
Label:
None
Purification:
Serum
Buffer System:
No additive
Purity:
Serum
State:
Serum
Specificity
Species:
Human
Gene ID 5918

Accessory Products

Proteins and/or Positive Controls

Proteins for RARRES1 (8 products)

Catalog No. Species Pres. Purity   Source  

RARRES1 (43-294, His-tag)

RARRES1 Human Purified > 90 % by SDS - PAGE E. coli
0.5 mg / €730.00
  Acris Antibodies GmbH

RARRES1 (43-294, His-tag)

RARRES1 Human Purified > 90 % by SDS - PAGE E. coli
0.1 mg / €300.00
  Acris Antibodies GmbH

RARRES1

RARRES1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

RARRES1

RARRES1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

RARRES1

RARRES1 Human 12.5% SDS-PAGE Stained with Coomassie Blue
  Abnova Taiwan Corp.

RARRES1

RARRES1 Human 12.5% SDS-PAGE Stained with Coomassie Blue
  Abnova Taiwan Corp.

RARRES1

RARRES1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

RARRES1

RARRES1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for RARRES1 (2 products)

Catalog No. Species Pres. Purity   Source  

RARRES1 293T Cell Transient Overexpression Lysate(Denatured)

RARRES1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

RARRES1 overexpression lysate

RARRES1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn