discontinued

H00005918-M06 RARRES1 antibody

See related secondary antibodies

Search for all "RARRES1"

Quick Overview

Mouse anti Human RARRES1 2E2

Product Description for RARRES1

Mouse anti Human RARRES1 2E2.
Presentation: Purified
Product is tested for Enzyme Immunoassay, Western blot / Immunoblot.

Properties for RARRES1

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms RAR-responsive protein TIG1, Retinoic acid receptor responder protein 1, TIG1, Tazarotene-induced gene 1 protein
Presentation Purified
Reactivity Hu
Applications E, WB
Clonality Monoclonal
Clone 2E2
Host Mouse
Isotype IgG2a
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
P49788
Immunogen:
RARRES1 (NP_996846, 205 a.a. ~ 295 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
AA Sequence:
EMTTQVSHYYLAQLTSVRQWKTNDDTIDFDYTVLLHELSTQEIIPCRIHLVWYPGKPLKVKYHCQELQTPEEASGT EEGSAVVPTELSNF*
GeneID:
5918
Remarks:
Gene Accession: NM_206963
Isotype control AM03096PU-N
Add. information Mouse monoclonal antibody raised against a partial recombinant RARRES1.

Antibody Reactive Against Recombinant Protein.
Application ELISA,WB-Ce,WB-Re
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 5918

Accessory Products

Proteins and/or Positive Controls

Proteins for RARRES1 (8 products)

Catalog No. Species Pres. Purity   Source  

RARRES1 (43-294, His-tag)

RARRES1 Human Purified > 90 % by SDS - PAGE E. coli
0.5 mg / €730.00
  Acris Antibodies GmbH

RARRES1 (43-294, His-tag)

RARRES1 Human Purified > 90 % by SDS - PAGE E. coli
0.1 mg / €300.00
  Acris Antibodies GmbH

RARRES1

RARRES1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

RARRES1

RARRES1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

RARRES1

RARRES1 Human 12.5% SDS-PAGE Stained with Coomassie Blue
  Abnova Taiwan Corp.

RARRES1

RARRES1 Human 12.5% SDS-PAGE Stained with Coomassie Blue
  Abnova Taiwan Corp.

RARRES1

RARRES1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

RARRES1

RARRES1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for RARRES1 (2 products)

Catalog No. Species Pres. Purity   Source  

RARRES1 293T Cell Transient Overexpression Lysate(Denatured)

RARRES1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

RARRES1 overexpression lysate

RARRES1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn