
NBP1-74143 RAS p21 antibody

See related secondary antibodies

Search for all "RAS p21"

Quick Overview

Rabbit anti Mouse RAS p21


Product Description for RAS p21

Rabbit anti Mouse RAS p21.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for RAS p21

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Ms
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to the C terminal of Rasa1. Immunizing peptide sequence SNKHRMIMFLDELGNVPELPDTTEHSRTDLSRDLAALHEICVAHSDELRT.
Background The function of this protein remains unknown.
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose.
Aff - Purified

Accessory Products

  • LinkedIn