H00064926-B01P RASAL3 antibody

See related secondary antibodies

Search for all "RASAL3"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human RASAL3

H00064926-B01P

Product Description for RASAL3

Mouse anti Human RASAL3.
Product is tested for Western blot / Immunoblot.

Properties for RASAL3

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms DKFZp667E013, FLJ00087, FLJ21438
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q86YV0
Immunogen:
RASAL3 (AAH30281.1, 1 a.a. ~ 264 a.a) full-length human protein.
AA Sequence:
MRLPLPPAQVHSSLSAGEKPGFLAPRDLPKHTPLISKSQSLRSVRRSESWARPRPDEERPLRRPRPVQRTQSVPVR RPARRRQSAGPWPRPKGSLSMGPAPRARPWTRDSASLPRKPSVPWQRQMDQPQDRNQALGTHRPVNKLAELQCEVA ALREEQKVLSRLVESLSTQIRALTEQQEQLRGQLQDLDSRLRAGSSEFDSEHNLTSNEGHSLKNLEHRLNEMERTQ AQLRDAVQSLQLSPRTRGSWSQPQPLKAPCLNGDTT
GeneID:
64926
Add. information Mouse polyclonal antibody raised against a full-length human RASAL3 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

  • LinkedIn