discontinued

H00010235-A01 RASGRP2 antibody

See related secondary antibodies

Search for all "RASGRP2"

Quick Overview

Mouse anti Human RASGRP2

Product Description for RASGRP2

Mouse anti Human RASGRP2.
Presentation: Serum
Product is tested for Enzyme Immunoassay, Western blot / Immunoblot.

Properties for RASGRP2

Product Category Primary Antibodies
Target Category
Quantity 50 µl
Synonyms CDC25L, CalDAG-GEFI, Calcium and DAG-regulated guanine nucleotide exchange factor I, Cdc25-like protein, MCG7, RAS guanyl-releasing protein 2
Presentation Serum
Reactivity Hu
Applications E, WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q7LDG7
Immunogen:
RASGRP2 (NP_005816, 65 a.a. ~ 165 a.a) partial recombinant protein with GST tag.
AA Sequence:
GTLDLDKGCTVEELLRGCIEAFDDSGKVRDPQLVRMFLMMHPWYIPSSQLAAKLLHIYQQSRKDNSNSLQVKTCHL VRYWISAFPAEFDLNPELAEQIKE*
GeneID:
10235
Remarks:
Gene Accession: NM_005825
Add. information Mouse polyclonal antibody raised against a partial recombinant RASGRP2.

Antibody Reactive Against Recombinant Protein.
Application ELISA,WB-Ce,WB-Re
Storage 50 % glycerol
Format
Label:
None
Purification:
Serum
Buffer System:
50 % glycerol
Purity:
Serum
State:
Serum
Specificity
Species:
Human
Gene ID 10235

Accessory Products

Proteins and/or Positive Controls

Proteins for RASGRP2 (9 products)

Catalog No. Species Pres. Purity   Source  

RASGRP2 (transcript variant 3)

RASGRP2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

RASGRP2 (transcript variant 4)

RASGRP2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

RASGRP2 (transcript variant 2)

RASGRP2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €438.00
  OriGene Technologies, Inc.

RASGRP2

RASGRP2 Human Purified
  Abnova Taiwan Corp.

RASGRP2

RASGRP2 Human Purified
  Abnova Taiwan Corp.

RASGRP2

RASGRP2 Human Purified
  Abnova Taiwan Corp.

RASGRP2

RASGRP2 Human Purified
  Abnova Taiwan Corp.

RASGRP2

RASGRP2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

RASGRP2

RASGRP2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for RASGRP2 (5 products)

Catalog No. Species Pres. Purity   Source  

RASGRP2 overexpression lysate

RASGRP2 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.

RASGRP2 overexpression lysate

RASGRP2 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.

RASGRP2 overexpression lysate

RASGRP2 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.

RASGRP2 overexpression lysate

RASGRP2 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

RASGRP2 overexpression lysate

RASGRP2 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn