discontinued

H00011228-M01 RASSF8 antibody

See related secondary antibodies

Search for all "RASSF8"

Quick Overview

Mouse anti Human, Mouse, Rat RASSF8 2G1

H00011228-M01

More Views

  • H00011228-M01
  • H00011228-M01
  • H00011228-M01
  • H00011228-M01

Product Description for RASSF8

Mouse anti Human, Mouse, Rat RASSF8 2G1.
Presentation: Purified
Product is tested for Enzyme Immunoassay, Immunocytochemistry/Immunofluorescence, Western blot / Immunoblot, Paraffin Sections.

Properties for RASSF8

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms C12orf2, Carcinoma-associated protein HOJ-1, Ras association domain-containing protein 8
Presentation Purified
Reactivity Hu, Ms, Rt
Applications E, ICC/IF, P, WB
Clonality Monoclonal
Clone 2G1
Host Mouse
Isotype IgG2a
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8NHQ8
Immunogen:
RASSF8 (NP_009142, 40 a.a. ~ 138 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
AA Sequence:
YTLIEKWRDTERHLAPHENPIISLNKWGQYASDVQLILRRTGPSLSERPTSDSVARIPERTLYRQSLPPLAKLRPQ IDKSIKRREPKRKSLTFTGGAK*
GeneID:
11228
Remarks:
Gene Accession: NM_007211
Isotype control AM03096PU-N
Add. information Mouse monoclonal antibody raised against a partial recombinant RASSF8.

Antibody Reactive Against Recombinant Protein.
Application ELISA,IF,IHC-P,WB-Ce,WB-Re
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human,Mouse,Rat
Gene ID 11228

Accessory Products

Proteins and/or Positive Controls

Proteins for RASSF8 (6 products)

Catalog No. Species Pres. Purity   Source  

RASSF8

RASSF8 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

RASSF8

RASSF8 Human in vitro transl.
  Abnova Taiwan Corp.

RASSF8

RASSF8 Human in vitro transl.
  Abnova Taiwan Corp.

RASSF8

RASSF8 Human in vitro transl.
  Abnova Taiwan Corp.

RASSF8

RASSF8 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

RASSF8

RASSF8 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for RASSF8 (3 products)

Catalog No. Species Pres. Purity   Source  

RASSF8 Lysate(Denatured)

RASSF8 Lysate(Denatured)
  Abnova Taiwan Corp.

RASSF8 Lysate

Western Blot: RASSF8 Lysate [NBL1-15180] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for RASSF8
  Novus Biologicals Inc.

RASSF8 overexpression lysate

RASSF8 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn