TA340161 RASSF8 antibody

Rabbit Polyclonal Anti-RASSF8 Antibody

See related secondary antibodies

Search for all "RASSF8"

50 µg / €360.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish RASSF8

Product Description for RASSF8

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish RASSF8.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for RASSF8

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms C12orf2, Carcinoma-associated protein HOJ-1, Ras association domain-containing protein 8
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for anti-RASSF8 antibody: synthetic peptide directed towards the N terminal of human RASSF8. Synthetic peptide located within the following region: GRTGRYTLIEKWRDTERHLAPHENPIISLNKWGQYASDVQLILRRTGPSL.
Application WB
Background The function of this protein remains unknown.
Affinity Purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

  • LinkedIn