
NBP1-55040 RBCK1 antibody

See related secondary antibodies

Search for all "RBCK1"

0.1 mg / €360.00

Quick Overview

Rabbit anti Bovine, Human, Mouse, Rat RBCK1

Product Description for RBCK1

Rabbit anti Bovine, Human, Mouse, Rat RBCK1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for RBCK1

Product Category Primary Antibodies
Quantity 0.1 mg
Synonyms C20orf18, HOIL1, RBCK2, RNF54, UBCE7IP3, XAP4, ZRANB4
Presentation Purified
Reactivity Bov, Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to C20ORF18 The peptide sequence was selected from the middle region of C20ORF18. Peptide sequence AYQVPASYQPDEEERARLAGEEEALRQYQQRKQQQQEGNYLQHVQLDQRS.
Background C20orf18 is similar to mouse UIP28/UbcM4 interacting protein.The protein encoded by this gene is similar to mouse UIP28/UbcM4 interacting protein. Alternative splicing has been observed at this locus, resulting in distinct isoforms.
Storage Store at -20C. Avoid freeze-thaw cycles.
IgG purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 100 ul of distilled water. Final antibody concentration is 1 mg/ml.
Gene ID 10616

Accessory Products

  • LinkedIn