discontinued

H00010616-D01P RBCK1 / RNF54 antibody

See related secondary antibodies

Search for all "RBCK1 / RNF54"

Quick Overview

Rabbit anti Human RBCK1 / RNF54

H00010616-D01P

More Views

  • H00010616-D01P

Product Description for RBCK1 / RNF54

Rabbit anti Human RBCK1 / RNF54.
Presentation: Purified
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for RBCK1 / RNF54

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms C20orf18, HBV-associated factor 4, Hepatitis B virus X-associated protein 4, RING finger protein 54, RanBP-type and C3HC4-type zinc finger-containing protein 1, UBCE7IP3, Ubiquitin-conjugating enzyme 7-interacting protein 3, XAP3, XAP4
Presentation Purified
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9BYM8
Immunogen:
RBCK1 (ENSP00000290048, 1 a.a. ~ 230 a.a) full-length human protein.
AA Sequence:
MGTATPDGREDQERLWVSVEDAQMHTVTIWLTVRPDMTVASLKDMVFLDYGFPPVLQQWVIGQRLARDQETLHSHG VRQNGDSAYLYLLSARNTSLNPQELQRERQLRMLEDLGFKDLTLQPRGPLEPGPPKPGVPQEPGRGQPDAVPEPPP VGWQCPGCTFINKPTRPGCEMCCRARPEAYQVPASYQPDEEERARLAGEEEALRQYQQGVPAGHHPQQPGGGGLLP LH
GeneID:
10616
Remarks:
Gene Accession: ENST00000290048
Add. information Rabbit polyclonal antibody raised against a full-length human RBCK1 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Ti,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 10616

Accessory Products

Proteins and/or Positive Controls

Proteins for RBCK1 / RNF54 (7 products)

Catalog No. Species Pres. Purity   Source  

RBCK1 / RNF54 (transcript variant 2)

RBCK1 / RNF54 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

RBCK1 / RNF54

RBCK1 / RNF54 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

RBCK1 / RNF54

RBCK1 / RNF54 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

RBCK1 / RNF54

RBCK1 / RNF54 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

RBCK1 / RNF54

RBCK1 / RNF54 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

RBCK1 / RNF54

RBCK1 / RNF54 Human
  Abnova Taiwan Corp.

RBCK1 / RNF54

RBCK1 / RNF54 Human
  Abnova Taiwan Corp.

Positive controls for RBCK1 / RNF54 (5 products)

Catalog No. Species Pres. Purity   Source  

C20orf18 293T Cell Transient Overexpression Lysate(Denatured)

C20orf18 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

RBCK1 Lysate

Western Blot: RBCK1 Lysate [NBL1-15187] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for RBCK1
  Novus Biologicals Inc.

RBCK1 Lysate

Western Blot: RBCK1 Lysate [NBL1-15188] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for RBCK1
  Novus Biologicals Inc.

RBCK1 overexpression lysate

RBCK1 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.

RBCK1 overexpression lysate

RBCK1 overexpression lysate
0.1 mg / €480.00
  OriGene Technologies, Inc.
  • LinkedIn