discontinued

H00084991-B01 RBM17 / SPF45 antibody

See related secondary antibodies

Search for all "RBM17 / SPF45"

Quick Overview

Mouse anti Human RBM17 / SPF45

Product Description for RBM17 / SPF45

Mouse anti Human RBM17 / SPF45.
Presentation: Serum
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for RBM17 / SPF45

Product Category Primary Antibodies
Target Category
Quantity 50 µl
Synonyms 45 kDa-splicing factor, RNA-binding motif protein 17, Splicing factor 45
Presentation Serum
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96I25
Immunogen:
RBM17 (NP_116294.1, 1 a.a. ~ 401 a.a) full-length human protein.
AA Sequence:
MSLYDDLGVETSDSKTEGWSKNFKLLQSQLQVKKAALTQAKSQRTKQSTVLAPVIDLKRGGSSDDRQIVDTPPHVA AGLKDPVPSGFSAGEVLIPLADEYDPMFPNDYEKVVKRQREERQRQRELERQKEIEEREKRRKDRHEASGFARRPD PDSDEDEDYERERRKRSMGGAAIAPPTSLVEKDKELPRDFPYEEDSRPRSQSSKAAIPPPVYEEQDRPRSPTGPSN SFLANMGGTVAHKIMQKYGFREGQGLGKHEQGLSTALSVEKTSKRGGKIIVGDATEKDASKKSDSNPLTEILKCPT KVVLLRNMVGAGEVDEDLEVETKEECEKYGKVGKCVIFEIPGAPDDEAVRIFLEFERVESAIKAVVDLNGRYFGGR VVKACFYNLDKFRVLDLAEQV
GeneID:
84991
Remarks:
Gene Accession: NM_032905
Add. information Mouse polyclonal antibody raised against a full-length human RBM17 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Tr
Storage No additive
Format
Label:
None
Purification:
Serum
Buffer System:
No additive
Purity:
Serum
State:
Serum
Specificity
Species:
Human
Gene ID 84991

Accessory Products

Proteins and/or Positive Controls

Proteins for RBM17 / SPF45 (7 products)

Catalog No. Species Pres. Purity   Source  

RBM17 / SPF45 (transcript variant 1)

RBM17 / SPF45 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €438.00
  OriGene Technologies, Inc.

RBM17 / SPF45 (1-401, His-tag)

RBM17 / SPF45 Human Purified > 90 % by SDS - PAGE E. coli
0.25 mg / €730.00
  Acris Antibodies GmbH

RBM17 / SPF45 (1-401, His-tag)

RBM17 / SPF45 Human Purified > 90 % by SDS - PAGE E. coli
50 µg / €300.00
  Acris Antibodies GmbH

RBM17 / SPF45

RBM17 / SPF45 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

RBM17 / SPF45

RBM17 / SPF45 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

RBM17 / SPF45

RBM17 / SPF45 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

RBM17 / SPF45

RBM17 / SPF45 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for RBM17 / SPF45 (2 products)

Catalog No. Species Pres. Purity   Source  

RBM17 293T Cell Transient Overexpression Lysate(Denatured)

RBM17 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

RBM17 Lysate

Western Blot: RBM17 Lysate [NBL1-15198] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for RBM17
  Novus Biologicals Inc.
  • LinkedIn