discontinued

NBP1-57548 RBM34 antibody

See related secondary antibodies

Search for all "RBM34"

50 µg / €390.00

Quick Overview

Rabbit anti Human RBM34

Product Description for RBM34

Rabbit anti Human RBM34.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for RBM34

Product Category Primary Antibodies
Quantity 50 µg
Synonyms KIAA0117
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
A8K8J7
Immunogen:
Synthetic peptides corresponding to RBM34(RNA binding motif protein 34) The peptide sequence was selected from the C terminal of RBM34. Peptide sequence SKPKQGLNFTSKTAEGHPKSLFIGEKAVLLKTKKKGQKKSGRPKKQRKQK.
Background RBM34 belongs to the RRM RBM34 family. It contains 2 RRM (RNA recognition motif) domains. The function of the RBM34 protein remains unknown.
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Aff - Purified

Accessory Products

  • LinkedIn