discontinued

H00055285-B01P RBM41 antibody

See related secondary antibodies

Search for all "RBM41"

Quick Overview

Mouse anti Human RBM41

H00055285-B01P

More Views

  • H00055285-B01P

Product Description for RBM41

Mouse anti Human RBM41.
Presentation: Purified
Product is tested for ELISA (detection), Immunocytochemistry/Immunofluorescence, Western blot / Immunoblot.

Properties for RBM41

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms RNA-binding motif protein 41, RNA-binding protein 41
Presentation Purified
Reactivity Hu
Applications E(detection), ICC/IF, WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96IZ5
Immunogen:
RP13-383K5.1 (NP_060771, 1 a.a. ~ 413 a.a) full-length human protein.
AA Sequence:
MKRVNSCVKSDEHVLEELETEGERQLKSLLQHQLDTSVSIEECMSKKESFAPGTMYKPFGKEAAGTMTLSQFQTLH EKDQETASLRELGLNETEILIWKSHVSGEKKTKLRATPEAIQNRLQDIEERISERQRILCLPQRFAKSKQLTRREM EIEKSLFQGADRHSFLKALYYQDEPQKKNKGDPMNNLESFYQEMIMKKRLEEFQLMRGEPFASHSLVSATSVGDSG TAESPSLLQDKGKQAAQGKGPSLHVANVIDFSPEQCWTGPKKLTQPIEFVPEDEIQRNRLSEEEIRKIPMFSSYNP GEPNKVLYLKNLSPRVTERDLVSLFARFQEKKGPPIQFRMMTGRMRGQAFITFPNKEIAWQALHLVNGYKLYGKIL VIEFGKNKKQRSNLQATSLISCATGSTTEISGS
GeneID:
55285
Remarks:
Gene Accession: NM_018301
Add. information Mouse polyclonal antibody raised against a full-length human RP13-383K5.1 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,IF,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 55285

Accessory Products

Proteins and/or Positive Controls

Proteins for RBM41 (3 products)

Catalog No. Species Pres. Purity   Source  

RBM41

RBM41 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €438.00
  OriGene Technologies, Inc.

RBM41

RBM41 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

RBM41

RBM41 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for RBM41 (4 products)

Catalog No. Species Pres. Purity   Source  

RBM41 293T Cell Transient Overexpression Lysate(Denatured)

RBM41 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

RBM41 Lysate

Western Blot: RBM41 Lysate [NBL1-15211] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for RBM41
  Novus Biologicals Inc.

RBM41 overexpression lysate

RBM41 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

RBM41 overexpression lysate

RBM41 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn