discontinued

H00005957-M37 Recoverin antibody

See related secondary antibodies

Search for all "Recoverin"

Quick Overview

Mouse anti Human Recoverin 3F6

H00005957-M37

More Views

  • H00005957-M37

Product Description for Recoverin

Mouse anti Human Recoverin 3F6.
Presentation: Purified
Product is tested for Enzyme Immunoassay, Western blot / Immunoblot.

Properties for Recoverin

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms Cancer-associated retinopathy protein, Protein CAR, RCV1, RCVRN
Presentation Purified
Reactivity Hu
Applications E, WB
Clonality Monoclonal
Clone 3F6
Host Mouse
Isotype IgG2a
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
P35243
Immunogen:
RCV1 (AAH01720, 1 a.a. ~ 201 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
AA Sequence:
MGNSKSGALSKEILEELQLNTKFSEEELCSWYQSFLKDCPTGRITQQQFQSIYAKFFPDTDPKAYAQHVFRSFDSN LDGTLDFKEYVIALHMTTAGKTNQKLEWAFSLYDVDGNGTISKNEVLEIVMAIFKMITPEDVKLLPDDENTPEKRA EKIWKYFGKNDDDKLTEKEFIEGTLANKEILRLIQFEPQKVKEKMKNA*
GeneID:
5957
Remarks:
Gene Accession: BC001720
Isotype control AM03096PU-N
Add. information Mouse monoclonal antibody raised against a full-length recombinant RCV1.

Antibody Reactive Against Recombinant Protein.
Application ELISA,S-ELISA,WB-Ce,WB-Re
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 5957

Accessory Products

Proteins and/or Positive Controls

Proteins for Recoverin (19 products)

Catalog No. Species Pres. Purity   Source  

Recoverin

Recoverin Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

Recoverin

Recoverin Human Purified > 95 % by SDS-PAGE E. coli
0.1 mg / €300.00
  Acris Antibodies GmbH

Recoverin

Recoverin Human Purified > 95 % E. coli
0.5 mg / €750.00
  Acris Antibodies GmbH

Recoverin

Recoverin Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Recoverin

Recoverin Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Recoverin

Recoverin Human Purified
  Abnova Taiwan Corp.

Recoverin

Recoverin Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Recoverin

Recoverin Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Recoverin

Recoverin Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Recoverin

Recoverin Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Recoverin

Recoverin Human Purified
  Abnova Taiwan Corp.

Recoverin

Recoverin Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Recoverin

Recoverin Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Recoverin

Recoverin Human
  Abnova Taiwan Corp.

Recoverin

Recoverin Human
  Abnova Taiwan Corp.

Recoverin

Recoverin Human
  Abnova Taiwan Corp.

Recoverin

Recoverin Human Purified > 95 % E. coli
20 µg / €190.00
  Neuromics Antibodies

Recoverin

Recoverin Human Purified > 95 % E. coli
50 µg / €290.00
  Neuromics Antibodies

Recoverin

SDS-Page: Recoverin Protein [NBC1-18499] - Recoverin, 23 kDa (200 aa), confirmed by MALDI-TOF with a purity of 95% by SDS - PAGE Protein
  Novus Biologicals Inc.

Positive controls for Recoverin (3 products)

Catalog No. Species Pres. Purity   Source  

RCV1 293T Cell Transient Overexpression Lysate(Denatured)

RCV1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

RCVRN overexpression lysate

RCVRN overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

Recoverin Lysate

Western Blot: Recoverin Lysate [NBL1-15251] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for RCVRN
  Novus Biologicals Inc.
  • LinkedIn