
NBP1-69712 RECQL5 antibody

See related secondary antibodies

Search for all "RECQL5"

Quick Overview

Rabbit anti Human RECQL5


Product Description for RECQL5

Rabbit anti Human RECQL5.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for RECQL5

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to RECQL5(RecQ protein-like 5) The peptide sequence was selected from the middle region of RECQL5. Peptide sequence CDHCQNPTAVRRRLEALERSSSWSKTCIGPSQGNGFDPELYEGGRKGYGD.
Background RECQL5 may have an important role in DNA metabolism.
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified

Accessory Products

  • LinkedIn