NBP1-90886 RELL1 antibody

See related secondary antibodies

Search for all "RELL1"

0.1 ml / €500.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human RELL1

NBP1-90886

More Views

  • NBP1-90886
  • NBP1-90886

Product Description for RELL1

Rabbit anti Human RELL1.
Presentation: Aff - Purified
Product is tested for Immunocytochemistry/Immunofluorescence, Paraffin Sections, Western blot / Immunoblot.

Properties for RELL1

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications ICC/IF, P, WB
Clonality Polyclonal
Host Rabbit
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8IUW5
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: NEANADVLKAMVADNSLYDPESPVTPSTPGSPPVSPGPLSPGGTPGKHVCGHHLHTVGGVVERDVCHRCRHKRWHFIKPTNKSRESRPRRQGEVTVLSVGRFRVTKVEHKSNQKERRSLMSVSGAETVNGE
GeneID:
768211
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Clear, colorless solution in phosphate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 768211

Accessory Products

Proteins and/or Positive Controls

Positive controls for RELL1 (1 products)

Catalog No. Species Pres. Purity   Source  

RELL1 overexpression lysate

RELL1 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn