
NBP1-59662 Reticulon 2 antibody

See related secondary antibodies

Search for all "Reticulon 2"

Quick Overview

Rabbit anti Human, Mouse, Rat Reticulon 2

Product Description for Reticulon 2

Rabbit anti Human, Mouse, Rat Reticulon 2.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for Reticulon 2

Product Category Primary Antibodies
Quantity 0.1 mg
Synonyms NSP2, NSPL1
Presentation Purified
Reactivity Hu, Ms, Rt
Applications P, WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to RTN2(reticulon 2) The peptide sequence was selected from the N terminal of RTN2. Peptide sequence MGQVLPVFAHCKEAPSTASSTPDSTEGGNDDSDFRELHTAREFSEEDEEE.
Background This gene belongs to the family of reticulon encoding genes. Reticulons are associated with the endoplasmic reticulum, and are involved in neuroendocrine secretion or in membrane trafficking in neuroendocrine cells.This gene belongs to the family of reticulon encoding genes. Reticulons are associated with the endoplasmic reticulum, and are involved in neuroendocrine secretion or in membrane trafficking in neuroendocrine cells. Alternatively spliced transcript variants encoding different isoforms have been identified.
Storage Store at -20C. Avoid freeze-thaw cycles.
IgG purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 100 ul of distilled water. Final antibody concentration is 1 mg/ml.

Accessory Products

  • LinkedIn