discontinued

H00005948-M02 Retinol-binding protein 2 / RBP2 antibody

See related secondary antibodies

Search for all "Retinol-binding protein 2 / RBP2"

Quick Overview

Mouse anti Human Retinol-binding protein 2 / RBP2 3G12

Product Description for Retinol-binding protein 2 / RBP2

Mouse anti Human Retinol-binding protein 2 / RBP2 3G12.
Presentation: Purified
Product is tested for Enzyme Immunoassay, Western blot / Immunoblot.

Properties for Retinol-binding protein 2 / RBP2

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms CRABP-II, CRABPII, CRBP-II, CRBP2, Cellular retinol-binding protein II
Presentation Purified
Reactivity Hu
Applications E, WB
Clonality Monoclonal
Clone 3G12
Host Mouse
Isotype IgG2a
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
P50120
Immunogen:
RBP2 (NP_004155, 45 a.a. ~ 135 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
AA Sequence:
QDGDNFKTKTTSTFRNYDVDFTVGVEFDEYTKSLDNRHVKALVTWEGDVLVCVQKGEKENRGWKQWIEGDKLYLEL TCGDQVCRQVFKKK*
GeneID:
5948
Remarks:
Gene Accession: NM_004164
Isotype control AM03096PU-N
Add. information Mouse monoclonal antibody raised against a partial recombinant RBP2.

Antibody Reactive Against Recombinant Protein.
Application ELISA,S-ELISA,WB-Re
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 5948

Accessory Products

Proteins and/or Positive Controls

Proteins for Retinol-binding protein 2 / RBP2 (7 products)

Catalog No. Species Pres. Purity   Source  

Retinol-binding protein 2 / RBP2

Retinol-binding protein 2 / RBP2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

Retinol-binding protein 2 / RBP2 (1-134, His-tag)

Retinol-binding protein 2 / RBP2 Human Purified > 95 % by SDS - PAGE E. coli
0.5 mg / €730.00
  Acris Antibodies GmbH

Retinol-binding protein 2 / RBP2 (1-134, His-tag)

Retinol-binding protein 2 / RBP2 Human Purified > 95 % by SDS - PAGE E. coli
0.1 mg / €300.00
  Acris Antibodies GmbH

Retinol-binding protein 2 / RBP2

Retinol-binding protein 2 / RBP2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Retinol-binding protein 2 / RBP2

Retinol-binding protein 2 / RBP2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Retinol-binding protein 2 / RBP2

Retinol-binding protein 2 / RBP2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Retinol-binding protein 2 / RBP2

Retinol-binding protein 2 / RBP2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for Retinol-binding protein 2 / RBP2 (1 products)

Catalog No. Species Pres. Purity   Source  

RBP2 overexpression lysate

RBP2 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn