TA330957 RFESD antibody

Rabbit polyclonal Anti-RFESD Antibody

See related secondary antibodies

Search for all "RFESD"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Yeast RFESD

Product Description for RFESD

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Yeast RFESD.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for RFESD

Product Category Primary Antibodies
Target Category
Quantity 0.1 ml
Synonyms Rieske domain-containing protein
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ye
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for anti-RFESD antibody: synthetic peptide directed towards the middle region of human RFESD. Synthetic peptide located within the following region: VVHDREVVIFYHKGEYHAMDIRCYHSGGPLHLGDIEDFDGRPCIVCPWHK.
Application WB
Background The specific function of this protein remains unknown.
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Positive controls for RFESD (1 products)

Catalog No. Species Pres. Purity   Source  

RFESD Lysate

Western Blot: RFESD Lysate [NBL1-15296] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for RFESD
  Novus Biologicals Inc.
  • LinkedIn