discontinued

H00117584-M01 RFFL / RNF189 antibody

See related secondary antibodies

Search for all "RFFL / RNF189"

Quick Overview

Mouse anti Human RFFL / RNF189 3A4

H00117584-M01

More Views

  • H00117584-M01

Product Description for RFFL / RNF189

Mouse anti Human RFFL / RNF189 3A4.
Presentation: Purified
Product is tested for Enzyme Immunoassay, Western blot / Immunoblot.

Properties for RFFL / RNF189

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms CARP-2, CARP2, Caspases-8 and -10-associated RING finger protein 2, E3 ubiquitin-protein ligase rififylin, FYVE-RING finger protein Sakura, Fring, RIFIFYLIN, RING finger protein 189, RING finger protein 34-like, RNF34L
Presentation Purified
Reactivity Hu
Applications E, WB
Clonality Monoclonal
Clone 3A4
Host Mouse
Isotype IgG2a
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8WZ73
Immunogen:
RFFL (NP_001017368, 2 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
AA Sequence:
WATCCNWFCLDGQPEEVPPPQGARMQAYSNPGYSSFPSPTGLEPSCKSCGAHFANTARKQTCLDCKKNFCMTCSSQ VGNGPRLCLLCQRFRATAFQRE*
GeneID:
117584
Remarks:
Gene Accession: NM_001017368
Isotype control AM03096PU-N
Add. information Mouse monoclonal antibody raised against a partial recombinant RFFL.

Antibody Reactive Against Recombinant Protein.
Application ELISA,RNAi-Ab,WB-Re,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 117584

Accessory Products

Proteins and/or Positive Controls

Proteins for RFFL / RNF189 (4 products)

Catalog No. Species Pres. Purity   Source  

RFFL / RNF189

RFFL / RNF189 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

RFFL / RNF189

RFFL / RNF189 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

RFFL / RNF189

RFFL / RNF189 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

RFFL / RNF189

RFFL / RNF189 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.
  • LinkedIn