discontinued

NBP1-55042 RFPL3 antibody

See related secondary antibodies

Search for all "RFPL3"

50 µg / €390.00

Quick Overview

Rabbit anti Human RFPL3

Product Description for RFPL3

Rabbit anti Human RFPL3.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for RFPL3

Product Category Primary Antibodies
Quantity 50 µg
Synonyms Ret finger protein-like 3
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8N5R4
Immunogen:
Synthetic peptides corresponding to RFPL3(ret finger protein-like 3) The peptide sequence was selected from the C terminal of RFPL3. Peptide sequence TVPLTFLLVDRKLQRVGIFLDMGMQNVSFFDAESGSHVYTFRSVSAEEPL.
GeneID:
10738
Background The function remains unknown.
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Aff - Purified
Gene ID 10738

Accessory Products

  • LinkedIn