TA343997 RG9MTD3 antibody

Rabbit Polyclonal Anti-RG9MTD3 Antibody

See related secondary antibodies

Search for all "RG9MTD3"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat RG9MTD3

Product Description for RG9MTD3

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat RG9MTD3.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for RG9MTD3

Product Category Primary Antibodies
Target Category
Quantity 0.1 ml
Synonyms RNA (guanine-9-)-methyltransferase domain-containing protein 3
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for anti-RG9MTD3 antibody: synthetic peptide directed towards the N terminal of human RG9MTD3. Synthetic peptide located within the following region: GEILATGSTAWCSKNVQRKQRHWEKIVAAKKSKRKQEKERRKANRAENPG.
Application WB
Background RG9MTD3 belongs to the R methyltransferase trmD family, TRM10 subfamily. It is a probable R methyltransferase.
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for RG9MTD3 (2 products)

Catalog No. Species Pres. Purity   Source  


RG9MTD3 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.


RG9MTD3 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for RG9MTD3 (3 products)

Catalog No. Species Pres. Purity   Source  

RG9MTD3 293T Cell Transient Overexpression Lysate(Denatured)

RG9MTD3 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

RG9MTD3 Lysate

Western Blot: RG9MTD3 Lysate [NBL1-15312] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for RG9MTD3
  Novus Biologicals Inc.

TRMT10B overexpression lysate

TRMT10B overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn