TA330962 RGD1306739 antibody

Rabbit polyclonal Anti-RGD1306739 Antibody

See related secondary antibodies

Search for all "RGD1306739"

50 µg / €325.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat RGD1306739

Product Description for RGD1306739

Rabbit anti Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat RGD1306739.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for RGD1306739

Product Category Primary Antibodies
Quantity 50 µg
Presentation Purified
Reactivity Can, Eq, GP, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for Anti-RGD1306739 antibody is: synthetic peptide directed towards the C-terminal region of Rat RGD1306739. Synthetic peptide located within the following region: PLGGFTIDDVKLALARVTDEVLISIQNEINEKLQVQEESFNARIEKLKKA.
Application WB
Background The function of this protein remains unknown.
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

  • LinkedIn