TA338309 RGD1308134 antibody

See related secondary antibodies

Search for all "RGD1308134"

50 µg / €325.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish RGD1308134

Product Description for RGD1308134

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish RGD1308134.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for RGD1308134

Product Category Primary Antibodies
Quantity 50 µg
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
B0BNM4
Immunogen:
The immunogen for anti-RGD1308134 antibody is: synthetic peptide directed towards the N-terminal region of Rat RGD1308134. Synthetic peptide located within the following region: VKRFGDDLNHISCVIKERTVAQIKTTVKRKVYEDSGIPLPAESPKKGPKK.
GeneID:
287452
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn