TA332198 RGD1564541 antibody

See related secondary antibodies

Search for all "RGD1564541"

50 µg / €325.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat RGD1564541

Product Description for RGD1564541

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat RGD1564541.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for RGD1564541

Product Category Primary Antibodies
Quantity 50 µg
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
D4A067
Immunogen:
The immunogen for Anti-RGD1564541 Antibody is: synthetic peptide directed towards the C-terminal region of Rat RGD1564541. Synthetic peptide located within the following region: GAVVKFGQGFGKTNIYTQKQEPPKKVMMTKRTKDMGKFSSVTVSTIDEEE.
GeneID:
313433
Application WB
Background The function of this protein remains unknown.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn