
NBP1-55301 RGS12 antibody

See related secondary antibodies

Search for all "RGS12"

50 µg / €420.00

Quick Overview

Rabbit anti Human, Mouse, Rat RGS12

Product Description for RGS12

Rabbit anti Human, Mouse, Rat RGS12.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for RGS12

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to RGS12(regulator of G-protein signaling 12) The peptide sequence was selected from the n terminal of RGS12. Peptide sequence RSVEVARGRAGYGFTLSGQAPCVLSCVMRGSPADFVGLRAGDQILAVNEI.
Background RGS12 is a member of the atrophin family of arginine-glutamic acid (RE) dipeptide repeat-containing proteins. RGS12 co-localizes with a transcription factor in the nucleus, and its overexpression triggers apoptosis. A similar protein in mouse associates with histone deacetylase and is thought to function as a transcriptional co-repressor during embryonic development.
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified

Accessory Products

  • LinkedIn