discontinued

H00008601-D01P RGS20 antibody

See related secondary antibodies

Search for all "RGS20"

Quick Overview

Rabbit anti Human, Mouse RGS20

H00008601-D01P

More Views

  • H00008601-D01P

Product Description for RGS20

Rabbit anti Human, Mouse RGS20.
Presentation: Purified
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for RGS20

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms Gz-GAP, RGSZ1, Regulator of G-protein signaling 20, Regulator of G-protein signaling Z1, Regulator of Gz-selective protein signaling 1, ZGAP1
Presentation Purified
Reactivity Hu, Ms
Applications E(detection), WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
O76081
Immunogen:
RGS20 (NP_003693.2, 1 a.a. ~ 241 a.a) full-length human protein.
AA Sequence:
MRTADGGEPAGASSPAGRVDGGLQMGSERMEMRKRQMPAAQDTPGAAPGQPGAGSRGSNACCFCWCCCCSCSCLTV RNQEDQRPTIASHELRADLPTWEESPAPTLEEVNAWAQSFDKLMVTPAGRNAFREFLRTEFSEENMLFWMACEELK KEANKNIIEEKARIIYEDYISILSPKEVSLDSRVREVINRNMVEPSQHIFDDAQLQIYTLMHRDSYPRFMNSAVYK DLLQSLSEKSIEA
GeneID:
8601
Remarks:
Gene Accession: NM_003702
Add. information Rabbit polyclonal antibody raised against a full-length human RGS20 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Ti,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human,Mouse
Gene ID 8601

Accessory Products

Proteins and/or Positive Controls

Proteins for RGS20 (5 products)

Catalog No. Species Pres. Purity   Source  

RGS20 (transcript variant 2)

RGS20 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €438.00
  OriGene Technologies, Inc.

RGS20

RGS20 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

RGS20

RGS20 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

RGS20

RGS20 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

RGS20

RGS20 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for RGS20 (3 products)

Catalog No. Species Pres. Purity   Source  

RGS20 293T Cell Transient Overexpression Lysate(Denatured)

RGS20 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

RGS20 Lysate

Western Blot: RGS20 Lysate [NBL1-15328] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for RGS20
  Novus Biologicals Inc.

RGS20 overexpression lysate

RGS20 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn