TA334733 RGS20 (all isoforms) antibody

Rabbit Polyclonal Anti-RGS20 Antibody

See related secondary antibodies

Search for all "RGS20"

0.1 mg / €360.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Chicken, Human, Mouse, Rat, Zebrafish, African clawed frog RGS20

TA334733

More Views

  • TA334733

Product Description for RGS20

Rabbit anti Bovine, Canine, Chicken, Human, Mouse, Rat, Zebrafish, African clawed frog RGS20.
Properties: (all isoforms)
Presentation: Aff - Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for RGS20

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms Gz-GAP, RGSZ1, Regulator of G-protein signaling 20, Regulator of G-protein signaling Z1, Regulator of Gz-selective protein signaling 1, ZGAP1
Presentation Aff - Purified
Reactivity African clawed frog, Bov, Can, Chk, Hu, Ms, Rt, Ze
Applications P, WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O76081
Immunogen:
The immunogen for anti-RGS20 antibody: synthetic peptide directed towards the middle region of human RGS20
AA Sequence:
NAFREFLRTEFSEENMLFWMACEELKKEANKNIIEEKARIIYEDYISILS
GeneID:
8601
Property all isoforms
Application Western blotting (2 - 4 µg/ml
Immunohistochemsitry on paraffin embedded sections (4 - 8 µg/ml)
Background Regulator of G protein signaling (RGS) proteins are regulatory and structural components of G protein-coupled receptor complexes. RGS proteins are GTPase-activating proteins for Gi and Gq class G-alpha proteins. They accelerate transit through the cycle of GTP binding and hydrolysis and thereby accelerate signaling kinetics and termination.
General Readings Xu,G.Y., et al., (2004) J. Biomol. NMR 28 (4), 409-4108
Storage Store lyophilized at 2-8°C or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for up to one month or in aliquots at -20°C long term. Avoid repeated freezing and thawing. Shelf life: one year from dispatch.
Format
Purification:
Purified using Protein A affinity column
State:
Lyophilized from PBS
Aff - Purified
Reconstitution:
Add 100 μl of distilled water to a final concentration of 1 mg/ml.
Species Reactivity
Species reactivity (expected):
Mouse, Rat, Dog, Zebrafish, Bovine, African clawed frog, Chicken
Species reactivity (tested):
Human
Specificity
Specificity:
This antibody wil detect all isoforms of RGS20.

Accessory Products

Proteins and/or Positive Controls

Proteins for RGS20 (5 products)

Catalog No. Species Pres. Purity   Source  

RGS20 (transcript variant 2)

RGS20 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €438.00
  OriGene Technologies, Inc.

RGS20

RGS20 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

RGS20

RGS20 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

RGS20

RGS20 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

RGS20

RGS20 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for RGS20 (3 products)

Catalog No. Species Pres. Purity   Source  

RGS20 293T Cell Transient Overexpression Lysate(Denatured)

RGS20 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

RGS20 Lysate

Western Blot: RGS20 Lysate [NBL1-15328] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for RGS20
  Novus Biologicals Inc.

RGS20 overexpression lysate

RGS20 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn