discontinued

NBP1-82126 RHBDF2 antibody

See related secondary antibodies

Search for all "RHBDF2"

Quick Overview

Rabbit anti Human RHBDF2

Product Description for RHBDF2

Rabbit anti Human RHBDF2.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Properties for RHBDF2

Product Category Primary Antibodies
Target Category
Quantity 0.1 ml
Synonyms RHBDL5, RHBDL6, Rhomboid 5 homolog 2, Rhomboid family member 2, Rhomboid veinlet-like protein 5, Rhomboid veinlet-like protein 6
Presentation Aff - Purified
Reactivity Hu
Applications P
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6PJF5
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: RKPPNLSITIPPPEKETQAPGEQDSMLPERKNPAYLKSVSLQEPRSRWQGSSEKRPGFRRQASLSQSIRKGAAQWFGVSGDWEGQRQQWQRRSLHHCSMRYGRLKASCQRDL
GeneID:
79651
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Clear, colorless solution in phosphate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 79651

Accessory Products

Proteins and/or Positive Controls

Positive controls for RHBDF2 (2 products)

Catalog No. Species Pres. Purity   Source  

RHBDF2 Lysate

Western Blot: RHBDF2 Lysate [NBL1-15344] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for RHBDF2
  Novus Biologicals Inc.

RHBDF2 overexpression lysate

RHBDF2 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn