TA344099 RhoD antibody

Rabbit Polyclonal Anti-RHOD Antibody

See related secondary antibodies

Search for all "RhoD"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Guinea Pig, Human, Rat RhoD

Product Description for RhoD

Rabbit anti Guinea Pig, Human, Rat RhoD.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for RhoD

Product Category Primary Antibodies
Target Category
Quantity 0.1 ml
Synonyms ARHD, Rho-related GTP-binding protein RhoD, Rho-related protein HP1, RhoHP1
Presentation Purified
Reactivity GP, Hu, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for anti-RHOD antibody: synthetic peptide directed towards the N terminal of human RHOD. Synthetic peptide located within the following region: TAAQAAGEEAPPGVRSVKVVLVGDGGCGKTSLLMVFADGAFPESYTPTVF.
Application WB
Background Ras homolog, or Rho, proteins interact with protein kises and may serve as targets for activated GTPase. They play a critical role in muscle differentiation. RHOD binds GTP and is a member of the small GTPase superfamily. It is involved in endosome dymics and reorganization of the actin cytoskeleton, and it may coordite membrane transport with the function of the cytoskeleton. Ras homolog, or Rho, proteins interact with protein kises and may serve as targets for activated GTPase. They play a critical role in muscle differentiation. The protein encoded by this gene binds GTP and is a member of the small GTPase superfamily. It is involved in endosome dymics and reorganization of the actin cytoskeleton, and it may coordite membrane transport with the function of the cytoskeleton. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additiol publications.
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for RhoD (8 products)

Catalog No. Species Pres. Purity   Source  


RhoD Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

RhoD (18-207, His-tag)

RhoD Human Purified > 90 % E. coli
50 µg / €820.00
  OriGene Technologies GmbH

RhoD (18-207, His-tag)

RhoD Human Purified > 90 % E. coli
10 µg / €320.00
  OriGene Technologies GmbH


RhoD Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.


RhoD Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.


RhoD Human Purified
  Novus Biologicals Inc.


RhoD Human Purified
  Novus Biologicals Inc.


RhoD Human Purified
  Novus Biologicals Inc.

Positive controls for RhoD (2 products)

Catalog No. Species Pres. Purity   Source  

RHOD Lysate

Western Blot: RhoD Lysate [NBL1-15356] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for RHOD
  Novus Biologicals Inc.

RHOD overexpression lysate

RHOD overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn