discontinued

H00114822-B01 Rhophilin 1 / RHPN1 antibody

See related secondary antibodies

Search for all "Rhophilin 1 / RHPN1"

Quick Overview

Mouse anti Human Rhophilin 1 / RHPN1

Product Description for Rhophilin 1 / RHPN1

Mouse anti Human Rhophilin 1 / RHPN1.
Presentation: Serum
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for Rhophilin 1 / RHPN1

Product Category Primary Antibodies
Target Category
Quantity 50 µl
Synonyms GTP-Rho-binding protein 1, KIAA1929, Rhophilin-1
Presentation Serum
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8TCX5
Immunogen:
RHPN1 (NP_443156.2, 1 a.a. ~ 670 a.a) full-length human protein.
AA Sequence:
MILEERPDGAGAGEESPRLQGCDSLTQIQCGQLQSRRAQIHQQIDKELQMRTGAENLYRATSNNRVRETVALELSY VNSNLQLLKEELEELSGGVDPGRHGSEAVTVPMIPLGLKETKELDWSTPLKELISVHFGEDGASYEAEIRELEALR QAMRTPSRNESGLELLTAYYNQLCFLDARFLTPARSLGLFFHWYDSLTGVPAQQRALAFEKGSVLFNIGALHTQIG ARQDRSCTEGARRAMEAFQRAAGAFSLLRENFSHAPSPDMSAASLCALEQLMMAQAQECVFEGLSPPASMAPQDCL AQLRLAQEAAQVAAEYRLVHRTMAQPPVHDYVPVSWTALVHVKAEYFRSLAHYHVAMALCDGSPATEGELPTHEQV FLQPPTSSKPRGPVLPQELEERRQLGKAHLKRAILGQEEALRLHALCRVLREVDLLRAVISQTLQRSLAKYAELDR EDDFCEAAEAPDIQPKTHQKPEARMPRLSQGKGPDIFHRLGPLSVFSAKNRWRLVGPVHLTRGEGGFGLTLRGDSP VLIAAVIPGSQAAAAGLKEGDYIVSVNGQPCRWWRHAEVVTELKAAGEAGASLQVVSLLPSSRLPSLGDRRPVLLG PRGLLRSQREHGCKTPASTWASPRPLLNWSRKAQQGKTGGCPQPCAPVKPAPPSSLKHPGWP
GeneID:
114822
Remarks:
Gene Accession: BC025767.1
Add. information Mouse polyclonal antibody raised against a full-length human RHPN1 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Tr
Storage No additive
Format
Label:
None
Purification:
Serum
Buffer System:
No additive
Purity:
Serum
State:
Serum
Specificity
Species:
Human
Gene ID 114822

Accessory Products

Proteins and/or Positive Controls

Proteins for Rhophilin 1 / RHPN1 (3 products)

Catalog No. Species Pres. Purity   Source  

Rhophilin 1 / RHPN1

Rhophilin 1 / RHPN1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

Rhophilin 1 / RHPN1

Rhophilin 1 / RHPN1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Rhophilin 1 / RHPN1

Rhophilin 1 / RHPN1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for Rhophilin 1 / RHPN1 (2 products)

Catalog No. Species Pres. Purity   Source  

RHPN1 293T Cell Transient Overexpression Lysate(Denatured)

RHPN1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

RHPN1 overexpression lysate

RHPN1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn