TA340220 Rhophilin 1 / RHPN1 antibody

Rabbit Polyclonal Anti-RHPN1 Antibody

See related secondary antibodies

Search for all "Rhophilin 1 / RHPN1"

50 µg / €360.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rat, Zebrafish Rhophilin 1 / RHPN1

Product Description for Rhophilin 1 / RHPN1

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rat, Zebrafish Rhophilin 1 / RHPN1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Rhophilin 1 / RHPN1

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms GTP-Rho-binding protein 1, KIAA1929, Rhophilin-1
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for anti-RHPN1 antibody: synthetic peptide directed towards the middle region of human RHPN1. Synthetic peptide located within the following region: SAKNRWRLVGPVHLTRGEGGFGLTLRGDSPVLIAAVIPGSQAAAAGLKEG.
Application WB
Background RHPN1¡¡has no enzymatic activity. RHPN1 may serve as a target for Rho, and interact with some cytoskeletal component upon Rho binding or relay a Rho sigl to other molecules.
Affinity Purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for Rhophilin 1 / RHPN1 (3 products)

Catalog No. Species Pres. Purity   Source  

Rhophilin 1 / RHPN1

Rhophilin 1 / RHPN1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

Rhophilin 1 / RHPN1

Rhophilin 1 / RHPN1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Rhophilin 1 / RHPN1

Rhophilin 1 / RHPN1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for Rhophilin 1 / RHPN1 (2 products)

Catalog No. Species Pres. Purity   Source  

RHPN1 293T Cell Transient Overexpression Lysate(Denatured)

RHPN1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

RHPN1 overexpression lysate

RHPN1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn