TA331440 RHOX11 antibody

Rabbit polyclonal Anti-RHOX11 Antibody

See related secondary antibodies

Search for all "RHOX11"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Mouse RHOX11

Product Description for RHOX11

Rabbit anti Mouse RHOX11.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for RHOX11

Product Category Primary Antibodies
Target Category
Quantity 0.1 ml
Synonyms Reproductive homeobox 11
Presentation Purified
Reactivity Ms
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for anti-RHOX11 antibody: synthetic peptide directed towards the N terminal of mouse RHOX11. Synthetic peptide located within the following region: VMPNTQDTGREEPEETSKVAETSEQSLFRIPRKAYRFTPGQLWELQAVFV.
Application WB
Background Homeobox proteins are transcription factors notable for their ability to regulate embryogenesis. The reproductive homeobox proteins (Rhox) are expressed in a cell type-specific manner; several are hormolly regulated, and their expression pattern during posttal testis development corresponds to their chromosomal position. Most of the Rhox proteins are expressed in Sertoli cells, the nurse cells in direct contact with developing male germ cells, suggesting that they regulate the expression of somatic-cell gene products critical for germ cell development.
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

  • LinkedIn