discontinued

H00084528-B01P RHOXF2 antibody

See related secondary antibodies

Search for all "RHOXF2"

Quick Overview

Mouse anti Human, Mouse, Rat RHOXF2

H00084528-B01P

More Views

  • H00084528-B01P
  • H00084528-B01P
  • H00084528-B01P

Product Description for RHOXF2

Mouse anti Human, Mouse, Rat RHOXF2.
Presentation: Purified
Product is tested for ELISA (detection), Immunocytochemistry/Immunofluorescence, Western blot / Immunoblot.

Properties for RHOXF2

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms PEPP-2, PEPP2, Paired-like homeobox protein PEPP-2, Rhox homeobox family member 2, THG1, Testis homeobox gene 1
Presentation Purified
Reactivity Hu, Ms, Rt
Applications E(detection), ICC/IF, WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9BQY4
Immunogen:
RHOXF2 (AAH21719, 1 a.a. ~ 289 a.a) full-length human protein.
AA Sequence:
MEPPDQCSQYMTSLLSPAVDDEKELQDMNAMVLSLTEEVKEEEEDAQPEPEQGTAAGEKLKSAGAQGGEEKDGGGE EKDGGGAGVPGHLWEGDLEGTSGSDGNVEDSDQSEKEPGQQYSRPRGAVGGLEPGNAQQPNVHAFTPLQLQELERI FQREQFPSEFLRRRLARSMNVTELAVQIWFENRRAKWRRHQRALMARNMLPFMAVGQPVMVTAAEAITAPLFISGM RDDYFWDHSHSSSLCFPMPPFPPPSLPLPLMLLPPMPPAGQAEFGPFPFVIVPSFTFPNV*
GeneID:
84528
Remarks:
Gene Accession: BC021719
Add. information Mouse polyclonal antibody raised against a full-length human RHOXF2 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,IF,WB-Ce,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human,Mouse,Rat
Gene ID 84528

Accessory Products

Proteins and/or Positive Controls

Proteins for RHOXF2 (4 products)

Catalog No. Species Pres. Purity   Source  

RHOXF2

RHOXF2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

RHOXF2

RHOXF2 Human in vitro transl.
  Abnova Taiwan Corp.

RHOXF2

RHOXF2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

RHOXF2

RHOXF2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for RHOXF2 (4 products)

Catalog No. Species Pres. Purity   Source  

PEPP-2 293T Cell Transient Overexpression Lysate(Denatured)

PEPP-2 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

PEPP-2 293T Cell Transient Overexpression Lysate(Denatured)

PEPP-2 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

RHOXF2 Lysate

Western Blot: RHOXF2 Lysate [NBL1-15362] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for RHOXF2
  Novus Biologicals Inc.

RHOXF2 overexpression lysate

RHOXF2 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn