discontinued

H00079608-B01P RIC3 antibody

See related secondary antibodies

Search for all "RIC3"

Quick Overview

Mouse anti Human RIC3

Product Description for RIC3

Mouse anti Human RIC3.
Presentation: Purified
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for RIC3

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms Protein RIC-3
Presentation Purified
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q7Z5B4
Immunogen:
RIC3 (NP_078833.2, 1 a.a. ~ 368 a.a) full-length human protein.
AA Sequence:
MAYSTVQRVALASGLVLALSLLLPKAFLSRGKRQEPPPTPEGKLGRFPPMMHHHQAHSDGQTPGARFQRSHLAEAF AKAKGSGGGAGGGGSGRGLMGQIIPIYGFGIFLYILYILFKLSKGKTTAEDGKCYTAMPGNTHRKITSFELAQLQE KLKETEAAMEKLFNRVGPNGERAQTVTSDQEKRLLHQLREITRVMKEGKFIDRFSPEKEAEEAPYMEDWEGYPEET YPIYDLSDCIKRRQETILVDYPDPKELSAEEIAERMGMIEEEESDHLGWESLPTDPRAQEDNSVTSCDPKPETCSC CFHEDEDPAVLAENAGFSADSYPEQEETTKEEWSQDFKDEGLGISTDKAYTGSMLRKRNPQGLE
GeneID:
79608
Remarks:
Gene Accession: NM_024557
Add. information Mouse polyclonal antibody raised against a full-length human RIC3 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 79608

Accessory Products

Proteins and/or Positive Controls

Proteins for RIC3 (2 products)

Catalog No. Species Pres. Purity   Source  

RIC3

RIC3 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

RIC3

RIC3 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for RIC3 (3 products)

Catalog No. Species Pres. Purity   Source  

RIC3 293T Cell Transient Overexpression Lysate(Denatured)

RIC3 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

RIC3 Lysate

Western Blot: RIC3 Lysate [NBL1-15367] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for RIBC3
  Novus Biologicals Inc.

RIC3 overexpression lysate

RIC3 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn