NBP1-91220 RLTPR antibody

See related secondary antibodies

Search for all "RLTPR"

0.1 ml / €500.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human RLTPR

Product Description for RLTPR

Rabbit anti Human RLTPR.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Properties for RLTPR

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P
Clonality Polyclonal
Host Rabbit
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6F5E8
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: EVNELCQSVQEHVELLGCGAGPQGEAAVRQAEDAIQNANFSLSILPILYEAGSSPSHHWQLGQKLEGLLRQVGEVCRQDIQDFTQ
GeneID:
146206
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Clear, colorless solution in phosphate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 146206

Accessory Products

Proteins and/or Positive Controls

Positive controls for RLTPR (1 products)

Catalog No. Species Pres. Purity   Source  

RLTPR overexpression lysate

RLTPR overexpression lysate
0.1 mg / €480.00
  OriGene Technologies, Inc.
  • LinkedIn