TA329878 RNF121 antibody

Rabbit Polyclonal Anti-RNF121 Antibody

See related secondary antibodies

Search for all "RNF121"

0.1 mg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human RNF121

TA329878

More Views

  • TA329878

Product Description for RNF121

Rabbit anti Human RNF121.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for RNF121

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms RING finger protein 121
Presentation Purified
Reactivity Hu
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9H920
Immunogen:
The immunogen for anti-RNF121 antibody: synthetic peptide directed towards the N terminal of human RNF121. Synthetic peptide located within the following region: WWRFLVIWILFSAVTAFVTFRATRKPLVQTTPRLVYKWFLLIYKISYATG.
GeneID:
55298
Application WB
IHC
Background The protein contains a RING finger, a motif present in a variety of functiolly distinct proteins and known to be involved in protein-protein and protein-D interactions.The protein encoded by this gene contains a RING finger, a motif present in a variety of functiolly distinct proteins and known to be involved in protein-protein and protein-D interactions. Multiple altertively spliced transcript variants encoding distinct isoforms have been reported. Three of them are supported by at least two independent transcripts or ESTs, the full length tures of others are not clear.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for RNF121 (2 products)

Catalog No. Species Pres. Purity   Source  

RNF121

RNF121 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

RNF121

RNF121 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.
  • LinkedIn