discontinued

NBP1-74097 RNF14 antibody

See related secondary antibodies

Search for all "RNF14"

50 µg / €390.00

Quick Overview

Rabbit anti Rat RNF14

NBP1-74097

Product Description for RNF14

Rabbit anti Rat RNF14.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for RNF14

Product Category Primary Antibodies
Quantity 50 µg
Synonyms ARA54
Presentation Aff - Purified
Reactivity Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q3ZAU6
Immunogen:
Synthetic peptides corresponding to the N terminal of Rnf14. Immunizing peptide sequence SAEDLEAQEDELLALASIYDGDEFRKAESVQGGETRIYLDLPQNFKIFVS.
GeneID:
619577
Background The function of this protein remains unknown.
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose.
State:
Aff - Purified
Gene ID 619577

Accessory Products

  • LinkedIn