
NBP1-55079 RNF175 antibody

See related secondary antibodies

Search for all "RNF175"

Quick Overview

Rabbit anti Human RNF175

Product Description for RNF175

Rabbit anti Human RNF175.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for RNF175

Product Category Primary Antibodies
Quantity 0.1 mg
Synonyms FLJ34190
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to RNF175(ring finger protein 175) The peptide sequence was selected from the middle region of RNF175. Peptide sequence YGLYYGVMGRDFAEICSDYMASTIGFYSVSRLPTRSLSDNICAVCGQKII.
Background The function remains unknown.
Storage Store at -20C. Avoid freeze-thaw cycles.
IgG purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 100 ul of distilled water. Final antibody concentration is 1 mg/ml.

Accessory Products

  • LinkedIn