
NBP1-54924 RNF98 antibody

See related secondary antibodies

Search for all "RNF98"

50 µg / €440.00

Quick Overview

Rabbit anti Human RNF98

Product Description for RNF98

Rabbit anti Human RNF98.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for RNF98

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to TRIM36(tripartite motif-containing 36) The peptide sequence was selected from the middle region of TRIM36. Peptide sequence GYIMELIAKGKASAMGLQQTHEHSRLTSKGGEARCPFEISEVGKQSLPRR.
Background The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. Multiple alternatively spliced transcript variants
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified
Gene ID 55521

Accessory Products

  • LinkedIn