NBP1-54924 RNF98 antibody

See related secondary antibodies

Search for all "RNF98"

50 µg / €440.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human RNF98

Product Description for RNF98

Rabbit anti Human RNF98.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for RNF98

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to TRIM36(tripartite motif-containing 36) The peptide sequence was selected from the middle region of TRIM36. Peptide sequence GYIMELIAKGKASAMGLQQTHEHSRLTSKGGEARCPFEISEVGKQSLPRR.
Background The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. Multiple alternatively spliced transcript variants
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified
Gene ID 55521

Accessory Products

  • LinkedIn