discontinued

NBP1-52827 ROR alpha antibody

See related secondary antibodies

Search for all "ROR alpha"

50 µg / €390.00

Quick Overview

Rabbit anti Human, Mouse, Rat ROR alpha

Product Description for ROR alpha

Rabbit anti Human, Mouse, Rat ROR alpha.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for ROR alpha

Product Category Primary Antibodies
Quantity 50 µg
Synonyms MGC119326, MGC119329, NR1F1, ROR1, ROR2, ROR3, RZRA
Presentation Aff - Purified
Reactivity Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
B6ZGS4
Immunogen:
Synthetic peptides corresponding to RORA(RAR-related orphan receptor A) The peptide sequence was selected from the N terminal of RORA. Peptide sequence ARKSEPPAPVRRQSYSSTSRGISVTKKTHTSQIEIIPCKICGDKSSGIHY.
Background The protein encoded by RORA is a member of the NR1 subfamily of nuclear hormone receptors. It can bind as a monomer or as a homodimer to hormone response elements upstream of several genes to enhance the expression of those genes. The specific functions of this protein are not known, but it has been shown to interact with NM23-2, a nucleoside diphosphate kinase involved in organogenesis and differentiation, as well as with NM23-1, the product of a tumor metastasis suppressor candidate gene. The protein encoded by this gene is a member of the NR1 subfamily of nuclear hormone receptors. It can bind as a monomer or as a homodimer to hormone response elements upstream of several genes to enhance the expression of those genes. The specific functions of this protein are not known, but it has been shown to interact with NM23-2, a nucleoside diphosphate kinase involved in organogenesis and differentiation, as well as with NM23-1, the product of a tumor metastasis suppressor candidate gene. Four transcript variants encoding different isoforms have been described for this gene.
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Aff - Purified

Accessory Products

  • LinkedIn