TA342197 RPA1 antibody

Rabbit polyclonal Anti-RPA1 Antibody

See related secondary antibodies

Search for all "RPA1"

50 µg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Mouse, Porcine, Rabbit, Rat, Sheep RPA1

Product Description for RPA1

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Mouse, Porcine, Rabbit, Rat, Sheep RPA1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for RPA1

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms REPA1, RF-A protein 1, RFA1, RP-A p70, RPA70, Replication factor A protein 1, Replication protein A, Replication protein A 70 kDa DNA-binding subunit, Single-stranded DNA-binding protein
Presentation Purified
Reactivity Bov, Can, Eq, GP, Ms, Por, Rb, Rt, Sh
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for anti-RPA1 antibody: synthetic peptide directed towards the middle region of human RPA1. Synthetic peptide located within the following region: SRGEGKLFSLELVDESGEIRATAFNEQVDKFFPLIEVNKVYYFSKGTLKI.
Application WB
Background RPA1 plays an essential role in several cellular processes in D metabolism including replication, recombition and D repair. RPA1 binds and subsequently stabilizes single-stranded D intermediates and thus prevents complementary D from reannealing
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for RPA1 (3 products)

Catalog No. Species Pres. Purity   Source  


RPA1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.


RPA1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.


RPA1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for RPA1 (3 products)

Catalog No. Species Pres. Purity   Source  

RPA1 293T Cell Transient Overexpression Lysate(Denatured)

RPA1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

RPA1 overexpression lysate

RPA1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

RPA70 Lysate

Western Blot: RPA70 Lysate [NBL1-15488] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for RPA1
  Novus Biologicals Inc.
  • LinkedIn