discontinued

H00006147-M10 RPL23A antibody

See related secondary antibodies

Search for all "RPL23A"

Quick Overview

Mouse anti Human RPL23A 3E11

Product Description for RPL23A

Mouse anti Human RPL23A 3E11.
Presentation: Purified
Product is tested for Enzyme Immunoassay, Western blot / Immunoblot.

Properties for RPL23A

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms 60S ribosomal protein L23a
Presentation Purified
Reactivity Hu
Applications E, WB
Clonality Monoclonal
Clone 3E11
Host Mouse
Isotype IgG2a
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
P62750
Immunogen:
RPL23A (NP_000975, 59 a.a. ~ 157 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
AA Sequence:
KYPRKSAPRRNKLDHYAIIKFPLTTESAMKKIEDNNTLVFIVDVKANKHQIKQAVKKLYDIDVAKVNTLIRPDGEK KAYVRLAPDYDALDVANKIGII*
GeneID:
6147
Remarks:
Gene Accession: NM_000984
Isotype control AM03096PU-N
Add. information Mouse monoclonal antibody raised against a partial recombinant RPL23A.

Antibody Reactive Against Recombinant Protein.
Application ELISA,WB-Re,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 6147

Accessory Products

Proteins and/or Positive Controls

Proteins for RPL23A (8 products)

Catalog No. Species Pres. Purity   Source  

RPL23A (1-156, His-tag)

RPL23A Human Purified > 80 % by SDS - PAGE E. coli
0.25 mg / €940.00
  OriGene Technologies GmbH

RPL23A (1-156, His-tag)

RPL23A Human Purified > 80 % by SDS - PAGE E. coli
50 µg / €370.00
  OriGene Technologies GmbH

RPL23A

RPL23A Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

RPL23A

RPL23A Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

RPL23A

RPL23A Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

RPL23A

RPL23A Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

RPL23A

RPL23A Human
  Abnova Taiwan Corp.

RPL23A

RPL23A Human
  Abnova Taiwan Corp.

Positive controls for RPL23A (1 products)

Catalog No. Species Pres. Purity   Source  

RPL23A overexpression lysate

RPL23A overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn