
NBP1-57370 RPL23AP82 antibody

See related secondary antibodies

Search for all "RPL23AP82"

Quick Overview

Rabbit anti Human RPL23AP82

Product Description for RPL23AP82

Rabbit anti Human RPL23AP82.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for RPL23AP82

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to MGC70863(similar to RPL23AP7 protein) The peptide sequence was selected from the N terminal of MGC70863. Peptide sequence MSLTFRRPKTLRLRRQPRYPRKSTPRRNKLGHYAIIKFPLATESAVKKIE.
Background The function of this protein remains unknown.
Concentration Lyoph mg/ml
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified
Gene ID 1087211

Accessory Products

  • LinkedIn